Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR-ENLERYLREQLGFEFKNAQ 4CSU Chain:W ((35-80)) --EAPLAIELDHDKVMNMQAKAEFYSEVLT----IVVDGKEIKVKAQDVQRH-------------

General information: TITO was launched using: RESULT: Template: 4CSU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 77 -8739 -113.49 -194.19 target 2D structure prediction score : 0.20 Monomeric hydrophicity matching model chain W : 0.73 3D Compatibility (PKB) : -113.49 2D Compatibility (Sec. Struct. Predict.) : 0.20 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.212

(partial model without unconserved sides chains): PDB file : Tito_4CSU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4CSU-query.scw PDB file : Tito_Scwrl_4CSU.pdb: