Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTMTMTQQMITIAMVVLGTMLTRFLPFMIFPSGKPTPKYVQYLGKVLPSAVIGLLVIYCLKDVSLLSGSHGIPELVGAAAVVLLHLWKKNMLLSIAGGTVVYMVLVQLVF 3J27 Chain:B ((38-50)) ----------------------------------------------------------------------------------------RHPGFTIMAAILA---------

General information: TITO was launched using: RESULT: Template: 3J27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 -1025 -205.00 -78.85 target 2D structure prediction score : 0.15 Monomeric hydrophicity matching model chain B : 0.36 3D Compatibility (PKB) : -205.00 2D Compatibility (Sec. Struct. Predict.) : 0.15 1D Compatibility (Hydrophobicity) : 0.36 QMean score : 0.353

(partial model without unconserved sides chains): PDB file : Tito_3J27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J27-query.scw PDB file : Tito_Scwrl_3J27.pdb: