Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----MTEKKQQNKPNENPEH--NDLTDPIPNEELKENMNDEKHKRQQRDNSQSERDYDTK 1NG7 Chain:A ((1-60)) MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA

General information: TITO was launched using: RESULT: Template: 1NG7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 112 16090 143.66 297.96 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 143.66 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_1NG7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NG7-query.scw PDB file : Tito_Scwrl_1NG7.pdb: