Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------MYWIEWIENGEKKNIVA-EGWIEWAAILEDLYQKRFEYVEWKRL----------------------------------------------------------------------------------------------------------
1UUN Chain:A ((1-184))GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITRPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN


General information:
TITO was launched using:
RESULT:

Template: 1UUN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 70 -2230 -31.85 -51.85
target 2D structure prediction score : 0.16
Monomeric hydrophicity matching model chain A : 0.51

3D Compatibility (PKB) : -31.85
2D Compatibility (Sec. Struct. Predict.) : 0.16
1D Compatibility (Hydrophobicity) : 0.51
QMean score : 0.179

(partial model without unconserved sides chains):
PDB file : Tito_1UUN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1UUN-query.scw
PDB file : Tito_Scwrl_1UUN.pdb: