Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGN-GDPQNFKLSQDDIKGIQKLYGKRSNSRKK
1D5J Chain:A ((1-169))FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTT-GTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPD----


General information:
TITO was launched using:
RESULT:

Template: 1D5J.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -72265 for 1272 contacts (-56.8/contact) +
2D Compatibility (PS) -18711 + (NN) -16344 + (LL) 376
1D Compatibility (HY) -15200 + (ID) 4650
Total energy: -126794.0 ( -99.68 by residue)
QMean score : 0.847

(partial model without unconserved sides chains):
PDB file : Tito_1D5J.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1D5J-query.scw
PDB file : Tito_Scwrl_1D5J.pdb: