Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------MISNQQQKDLKKRAAFKKLNVAMNSYVELLFLSVPLIHIFKWLGSLALHLIH----------------------------------
3HCY Chain:A ((-2-145))AIEEVYEATLDAIQGALNCDRASILLFDEAGTMRFVAARGLSEHYQRAVDGHSPWINEPEPIFVENVDDAEFSRELKESIVGEGIAALGFFPLVTEGRLIGKFMTYYDRPHRFADSEIGMALTIARQLGFSIQRMRAEYARRQ


General information:
TITO was launched using:
RESULT:

Template: 3HCY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 132 -106 -0.80 -2.04
target 2D structure prediction score : 0.25
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : -0.80
2D Compatibility (Sec. Struct. Predict.) : 0.25
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.101

(partial model without unconserved sides chains):
PDB file : Tito_3HCY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3HCY-query.scw
PDB file : Tito_Scwrl_3HCY.pdb: