Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQSNYRPSVPRWVGDILELDKKRRQNQYRGSLTSGQEKKDWDEWKRRYSRKLKYARLNGWTIEEE 2Y6I Chain:A ((629-661)) ----------------------------YTGETSKG-EFKDWDEMSKKLDGTLESLAKNSWS----

General information: TITO was launched using: RESULT: Template: 2Y6I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 19 1865 98.16 56.52 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : 98.16 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.569

(partial model without unconserved sides chains): PDB file : Tito_2Y6I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Y6I-query.scw PDB file : Tito_Scwrl_2Y6I.pdb: