Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHVVELRSTNHKDIDADFVLNAKQTYIESVLNIRKMIVNAKTEDDLHGAKIEIAALLKDLNRVLLGGDGLKRSIENNPHFRSLIHFVKNLKRHIAIEFEEFIYQP 4R5T Chain:A ((631-666)) --------------------------------------------------------------------GFKSYIVSLPQDRYIINFVSNLDTDVLADTKEYIYK-

General information: TITO was launched using: RESULT: Template: 4R5T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -7677 -191.93 -213.25 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -191.93 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.478

(partial model without unconserved sides chains): PDB file : Tito_4R5T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4R5T-query.scw PDB file : Tito_Scwrl_4R5T.pdb: