Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------------------------------------------------MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR------------------------------------------------- 1DDT Chain:? ((200-380)) SCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADN------LEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAY

General information: TITO was launched using: RESULT: Template: 1DDT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 42 -1429 -34.02 -28.58 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -34.02 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.215

(partial model without unconserved sides chains): PDB file : Tito_1DDT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DDT-query.scw PDB file : Tito_Scwrl_1DDT.pdb: