Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------------MKKAERGASPKQIKPHRYYLLAVH--------------------------------------------------------------------------
2E74 Chain:B ((1-160))MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF


General information:
TITO was launched using:
RESULT:

Template: 2E74.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 28 -3471 -123.96 -144.63
target 2D structure prediction score : 0.75
Monomeric hydrophicity matching model chain B : 0.43

3D Compatibility (PKB) : -123.96
2D Compatibility (Sec. Struct. Predict.) : 0.75
1D Compatibility (Hydrophobicity) : 0.43
QMean score : 0.603

(partial model without unconserved sides chains):
PDB file : Tito_2E74.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2E74-query.scw
PDB file : Tito_Scwrl_2E74.pdb: