Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVYSDRQLAKDQAARLRQGFSAYAETNSLASLIKKELQSHNLQVYEDLTDFGCWFIPVTDEH 3BZY Chain:B ((25-48)) --------------------------KDAKALQIIKLAELYDIPVIEDIP-------------

General information: TITO was launched using: RESULT: Template: 3BZY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 10 -2893 -289.25 -120.52 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -289.25 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.756

(partial model without unconserved sides chains): PDB file : Tito_3BZY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BZY-query.scw PDB file : Tito_Scwrl_3BZY.pdb: