Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVQHKKELKFYCIVTIPSAFVVLTVISFLLQEITFPVTASAFLNASWHNLLFLIPFGLFFYPVHIWMKREFGRWNDTEKKRG- 2K7W Chain:B ((1-20)) ----------------------------------------------------------------EIWIAQELRRIGDEFNAYYA

General information: TITO was launched using: RESULT: Template: 2K7W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 6 1042 173.58 54.82 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain B : 0.42 3D Compatibility (PKB) : 173.58 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.42 QMean score : 0.455

(partial model without unconserved sides chains): PDB file : Tito_2K7W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K7W-query.scw PDB file : Tito_Scwrl_2K7W.pdb: