Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLFQHFGLTVGQWSIIIGALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYTGSIIVFSLGVVLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFAAWGMGGPIGFGTILTAILTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH 3T1E Chain:E ((79-115)) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DVVDRIYKQVALESPLALLNTESIIMNAITSLSYQIN

General information: TITO was launched using: RESULT: Template: 3T1E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 5 492 98.30 13.28 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain E : 0.38 3D Compatibility (PKB) : 98.30 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.38 QMean score : 0.172

(partial model without unconserved sides chains): PDB file : Tito_3T1E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3T1E-query.scw PDB file : Tito_Scwrl_3T1E.pdb: