Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------MKILGVTGFILI------CL----------LAISVLMDMLQGFS--LTKAVYNNMSSFKMTTFAEWVVLLFFVL-------VLVREMYVIYKSKKKNP 2JQO Chain:A ((1-108)) MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELLLEHHHHHH

General information: TITO was launched using: RESULT: Template: 2JQO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 276 -70230 -254.46 -962.05 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -254.46 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.130

(partial model without unconserved sides chains): PDB file : Tito_2JQO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JQO-query.scw PDB file : Tito_Scwrl_2JQO.pdb: