Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKISRILLAAVILSSVFSITYLQSDHNTEIKVAADRVGA 2L36 Chain:A ((6-15)) -----------------------------LKKAKKGIGA

General information: TITO was launched using: RESULT: Template: 2L36.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 -128 -128.00 -12.80 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -128.00 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.835

(partial model without unconserved sides chains): PDB file : Tito_2L36.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L36-query.scw PDB file : Tito_Scwrl_2L36.pdb: