Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVTFPSSGCPSFFNIFYEEGIVMKLTIYYDGQFWVGVVEVVDNGKLRAFRHLFGKEPRDSEVLEFVHNQLLNMMAQAEQEGVRLQGRRQKKINPKRLQRQVSKELKNAGVTSKAQEAIKLELEARKQKKKQIMKEQREHVKEQRYMLKKQKAKKKHRGK 3PJA Chain:J ((32-92)) ------------------------------------------------------------------------------------------------------------SSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESK---------------

General information: TITO was launched using: RESULT: Template: 3PJA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain J - contact count / total energy / energy per contact / energy per residue : 7 -40 -5.64 -1.07 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain J : 0.59 3D Compatibility (PKB) : -5.64 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.930

(partial model without unconserved sides chains): PDB file : Tito_3PJA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PJA-query.scw PDB file : Tito_Scwrl_3PJA.pdb: