Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MY-WIEW-IENGEKKNIVAEGWIEWAAILEDLYQKRFEYVEWKRL--------------
3DKQ Chain:A ((14-243))NLYFQGMLIEIPNVFSKQEVSHLREQLDARRWIDGNQTSGAMATTRKRNQQLDKDDPVAVALGQQIMDRLLAHPQFVSAALPLQFYPPLFNRYQGGETFGYHIDNAIRSTPDGMIRTDLSATLFLSEPENYQGGELVIQDTYGQQSIKLSAGSLVLYPSSSLHQVTPVLSGERTAAFMWLQSMVRDEGQRRLL----FQLDQSIQSLTAQTAAEQELFNLSGVYHNLLRRWSEL


General information:
TITO was launched using:
RESULT:

Template: 3DKQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 20 -152 -7.60 -3.90
target 2D structure prediction score : 0.51
Monomeric hydrophicity matching model chain A : 0.54

3D Compatibility (PKB) : -7.60
2D Compatibility (Sec. Struct. Predict.) : 0.51
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.191

(partial model without unconserved sides chains):
PDB file : Tito_3DKQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3DKQ-query.scw
PDB file : Tito_Scwrl_3DKQ.pdb: