Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVA--NSPDLTVNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL 4M6B Chain:C ((598-628)) ----------------------------SVGLSALFDLDLDDSEDFTVNSS------------------------------------------

General information: TITO was launched using: RESULT: Template: 4M6B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 6 -1806 -301.00 -86.00 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain C : 0.36 3D Compatibility (PKB) : -301.00 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.36 QMean score : 0.220

(partial model without unconserved sides chains): PDB file : Tito_4M6B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4M6B-query.scw PDB file : Tito_Scwrl_4M6B.pdb: