Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ 1Z65 Chain:A ((13-24)) ---------------------------------------LCMLLASHLSTV-------

General information: TITO was launched using: RESULT: Template: 1Z65.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 6 -1709 -284.83 -142.42 target 2D structure prediction score : 0.08 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -284.83 2D Compatibility (Sec. Struct. Predict.) : 0.08 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.664

(partial model without unconserved sides chains): PDB file : Tito_1Z65.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Z65-query.scw PDB file : Tito_Scwrl_1Z65.pdb: