Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL 2ZSH Chain:B ((23-88)) -----------GMDELLAVLGYK------------VRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDL

General information: TITO was launched using: RESULT: Template: 2ZSH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 147 -16365 -111.32 -277.36 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -111.32 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.186

(partial model without unconserved sides chains): PDB file : Tito_2ZSH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZSH-query.scw PDB file : Tito_Scwrl_2ZSH.pdb: