Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKFSVILGMIRCSLTHITTKNTVNALKRMIYPKQKPSFFHEFKVLYKLLKKFCIKGIMIKNIRSCMGYFL 4R29 Chain:A ((21-44)) ------------------------H-VVKNIYPEIKHDYFNESPNIYD-----------------------

General information: TITO was launched using: RESULT: Template: 4R29.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 16 -953 -59.56 -41.43 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -59.56 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.367

(partial model without unconserved sides chains): PDB file : Tito_4R29.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4R29-query.scw PDB file : Tito_Scwrl_4R29.pdb: