Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAIIIAIIAAVIVIAALITFNVRNASPGPEKQEATDRIAPPEEEKNEAHYPAEARAAEHTPSVVKNDSPKEKRDTMGDDIYRQALQKFKHSDEVHAEEEVTEESDKMQDRSYRDALLSMKNKKK 2L8S Chain:A ((12-25)) --ILLSAFAGLLLLML------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2L8S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -876 -291.83 -62.54 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -291.83 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 1.538

(partial model without unconserved sides chains): PDB file : Tito_2L8S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L8S-query.scw PDB file : Tito_Scwrl_2L8S.pdb: