Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQ--KLGHKQADSILTLLKLANEKHITL 3QKS Chain:C ((353-376)) --------------------------------------------------------------EFELKIIDIL------DFDYIIKL--------

General information: TITO was launched using: RESULT: Template: 3QKS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 15 -3321 -221.37 -207.53 target 2D structure prediction score : 0.00 Monomeric hydrophicity matching model chain C : 0.55 3D Compatibility (PKB) : -221.37 2D Compatibility (Sec. Struct. Predict.) : 0.00 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.843

(partial model without unconserved sides chains): PDB file : Tito_3QKS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QKS-query.scw PDB file : Tito_Scwrl_3QKS.pdb: