Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --MGKKHRNRITGQKKNNHIPEKDIIAAEEA--HGKEYSAAKRKP 1P9C Chain:A ((263-307)) MTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESAD

General information: TITO was launched using: RESULT: Template: 1P9C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 44 4189 95.19 102.16 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 95.19 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.481

(partial model without unconserved sides chains): PDB file : Tito_1P9C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1P9C-query.scw PDB file : Tito_Scwrl_1P9C.pdb: