Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEKYETNGYDTSIVYDYKEYPDVKYGRCDNCDYTLFKSSVKSGIFLRECRRCGMKKSI 2LK0 Chain:A ((7-29)) -------------------------DWLCNKCCLNNFRKRL-------KCFRCGADKF-

General information: TITO was launched using: RESULT: Template: 2LK0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 61 -6816 -111.74 -296.35 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -111.74 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.411

(partial model without unconserved sides chains): PDB file : Tito_2LK0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LK0-query.scw PDB file : Tito_Scwrl_2LK0.pdb: