Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALELIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIAREDSR 1UJK Chain:A ((93-119)) -----------------------------------------------------------ELIKVVSPKYLGSRTSEKVKNKILELL-------------------------------------

General information: TITO was launched using: RESULT: Template: 1UJK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 53 -3938 -74.29 -145.83 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -74.29 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.726

(partial model without unconserved sides chains): PDB file : Tito_1UJK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UJK-query.scw PDB file : Tito_Scwrl_1UJK.pdb: