Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRYMKLFFLVTDIGFILYWLSAGFSLIPESWAFKHHDHPFMIAWNWSFFPLDILISVTGLYSLYLQRVNRADWKLMALISLVLTCCSGLQALSFWTFSSDFDLVWWLFNGYLLIYPLFFIHLLLKEGRRTKQS 2LXN Chain:A ((71-84)) --------------------------------------------------------------------------------PILGICLGHQLIAL---------------------------------------

General information: TITO was launched using: RESULT: Template: 2LXN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 10 -881 -88.05 -62.89 target 2D structure prediction score : 0.14 Monomeric hydrophicity matching model chain A : 0.39 3D Compatibility (PKB) : -88.05 2D Compatibility (Sec. Struct. Predict.) : 0.14 1D Compatibility (Hydrophobicity) : 0.39 QMean score : 0.851

(partial model without unconserved sides chains): PDB file : Tito_2LXN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LXN-query.scw PDB file : Tito_Scwrl_2LXN.pdb: