Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKDPSDYTVTQESVLKLIQEQKRMNREMITELEQIHGPFPISHDIQYIKVLLDSSNTHIVQDLMSVSKQLYKKTL 3W3A Chain:G ((139-183)) -------VANTETRLKKIGEEIKKTTR-RVNALEQVV-IPGIRAQIRFIQQVLE----------------------

General information: TITO was launched using: RESULT: Template: 3W3A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 27 -1903 -70.46 -42.28 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain G : 0.67 3D Compatibility (PKB) : -70.46 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.345

(partial model without unconserved sides chains): PDB file : Tito_3W3A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3W3A-query.scw PDB file : Tito_Scwrl_3W3A.pdb: