Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKEKLSDHLKSEWKKIDQ-TAN-PS-IPNQKELLHQLSQMKAEYRKKLLQEIILFVFCALMVVSAAILAFTQAPAVFIVLQVCVLAVLPILIAAEKKRHLGECEVKRG 3ONJ Chain:A ((48-91)) ---------LFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPL--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3ONJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 57 1155 20.25 28.16 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : 20.25 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.757

(partial model without unconserved sides chains): PDB file : Tito_3ONJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ONJ-query.scw PDB file : Tito_Scwrl_3ONJ.pdb: