Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQ---FNLVHGSDSAESAQREIALWFPGA
2DY9 Chain:A ((7-140))-TERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP-KDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFF---


General information:
TITO was launched using:
RESULT:

Template: 2DY9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -78767 for 1020 contacts (-77.2/contact) +
2D Compatibility (PS) -14147 + (NN) -5108 + (LL) 232
1D Compatibility (HY) -16000 + (ID) 3800
Total energy: -117590.0 ( -115.28 by residue)
QMean score : 0.537

(partial model without unconserved sides chains):
PDB file : Tito_2DY9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2DY9-query.scw
PDB file : Tito_Scwrl_2DY9.pdb: