Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------------------------------------------MLGRTKLGNRNAQANNNAKKKNGFQTH------FDSYAGREAEKLIASNKRHND------------------------------------------------------------------------------------------------------------------------
4E5V Chain:A ((2-281))RKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN


General information:
TITO was launched using:
RESULT:

Template: 4E5V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 117 21324 182.25 444.24
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain A : 0.54

3D Compatibility (PKB) : 182.25
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.498

(partial model without unconserved sides chains):
PDB file : Tito_4E5V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4E5V-query.scw
PDB file : Tito_Scwrl_4E5V.pdb: