Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR
1SIY Chain:A ((1-91))-MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVR-GINPNNAEALPGKCGVNIPYKISTSTNCNSIN


General information:
TITO was launched using:
RESULT:

Template: 1SIY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -68613 for 700 contacts (-98.0/contact) +
2D Compatibility (PS) -9313 + (NN) 841 + (LL) 116
1D Compatibility (HY) -10400 + (ID) 2000
Total energy: -89369.0 ( -127.67 by residue)
QMean score : 0.468

(partial model without unconserved sides chains):
PDB file : Tito_1SIY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1SIY-query.scw
PDB file : Tito_Scwrl_1SIY.pdb: