Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------QNICPRVNRIVPPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVSRNPGL---------TQNPRFQNIPRDCRNTFVRPFWW-----RPRIQCGRINLTDKLIYLD-AEE-------------------------------------------------
1VEC Chain:A ((1-206))KGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKK------DNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV----QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEIN


General information:
TITO was launched using:
RESULT:

Template: 1VEC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -47801 for 592 contacts (-80.7/contact) +
2D Compatibility (PS) -9809 + (NN) -941 + (LL) 252
1D Compatibility (HY) -4800 + (ID) 650
Total energy: -63749.0 ( -107.68 by residue)
QMean score : 0.252

(partial model without unconserved sides chains):
PDB file : Tito_1VEC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1VEC-query.scw
PDB file : Tito_Scwrl_1VEC.pdb: