Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------------MGAYNTAPKDLRLIVFLGHLTINNFIILYSIVSIIRNFMSIDKKLKILPNK-VLIIVTLVPKDTEKM-LQDDKNSKFIMLIY----------------------------------------------------------
4H08 Chain:A ((1-200))GREYIEWSDIWIPGANKTDLPHVLLIGNSITRGYYGKVEAALKEKAYVGRLSNSKSVGDPALIEELAVVLKNTKFDVIHFNNGLHG--FDYTEEEYDKSFPKLIKIIRKYAPKAKLIWANTTPVRTGEGMKEFAPITERLNVRNQIALKHINRASIEVNDLWKVVIDHPEYYAGGDGTHPIDAGYSALANQVIKVIKNVLVH


General information:
TITO was launched using:
RESULT:

Template: 4H08.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -25601 for 424 contacts (-60.4/contact) +
2D Compatibility (PS) -8340 + (NN) 223 + (LL) 336
1D Compatibility (HY) 800 + (ID) 500
Total energy: -33082.0 ( -78.02 by residue)
QMean score : 0.136

(partial model without unconserved sides chains):
PDB file : Tito_4H08.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4H08-query.scw
PDB file : Tito_Scwrl_4H08.pdb: