Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
3FYW Chain:X ((1-158))-TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK


General information:
TITO was launched using:
RESULT:

Template: 3FYW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -121867 for 1180 contacts (-103.3/contact) +
2D Compatibility (PS) -16352 + (NN) -1799 + (LL) 208
1D Compatibility (HY) -24000 + (ID) 7900
Total energy: -171710.0 ( -145.52 by residue)
QMean score : 0.613

(partial model without unconserved sides chains):
PDB file : Tito_3FYW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3FYW-query.scw
PDB file : Tito_Scwrl_3FYW.pdb: