Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKQKLLLSGLAVSTVGITSYLLKDPSNRQKAREFIHSMKMKITKQPDMETFPVDKAGHPDPQDIEDNKMVSEGSMYPVQ-YYDEKKK 3RKL Chain:A ((2-81)) SKITINIKDNTIEYGHKEFVLSNLQEDIKNLAEIVYQLAKLIEKLSQYE----EEVDTELYNLLHEYAIYLAGAT---SMFIDSENK

General information: TITO was launched using: RESULT: Template: 3RKL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 194 -17438 -89.89 -220.73 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -89.89 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.176

(partial model without unconserved sides chains): PDB file : Tito_3RKL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3RKL-query.scw PDB file : Tito_Scwrl_3RKL.pdb: