Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRREERNMDKLLISFLLSLFMVYFPPSDVVLPSQFEASTDSYVPMSSYPQETQSAKTPSPGSMHPAELIKEYSPLAQSVRQLSVKPL-DEPLINRLEKALAVPVKYQSNYLRI 5AA5 Chain:H ((290-336)) --------------------------------------------MPGFPDKFMPFMDAPPGAVLSSNLIKSYGPLIRSLRKLTKDTLNDEP----------------------

General information: TITO was launched using: RESULT: Template: 5AA5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 23 1234 53.65 26.83 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain H : 0.61 3D Compatibility (PKB) : 53.65 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.610

(partial model without unconserved sides chains): PDB file : Tito_5AA5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AA5-query.scw PDB file : Tito_Scwrl_5AA5.pdb: