Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA--------------------------------------------------------------- 1YHU Chain:D ((1-149)) AASCTTEDRREMQLMWGNVWSAQFTGRRIAIAQAVFKDLFANV-----PDAVGLFGAVKGDEVNSNEFKAHCIRVVNGLDSSIGLLSDPATLNEQLSHLATQHKARSGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITTGMTEPLPA

General information: TITO was launched using: RESULT: Template: 1YHU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 81 -9783 -120.77 -191.81 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain D : 0.59 3D Compatibility (PKB) : -120.77 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.347

(partial model without unconserved sides chains): PDB file : Tito_1YHU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YHU-query.scw PDB file : Tito_Scwrl_1YHU.pdb: