Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGI---YQMQKKDGGLE 4F4V Chain:A ((1-21)) ---------------------------------------------GIVEQCCTSICSLYQLENYCN---

General information: TITO was launched using: RESULT: Template: 4F4V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 25 -1237 -49.46 -68.69 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.38 3D Compatibility (PKB) : -49.46 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.38 QMean score : 0.102

(partial model without unconserved sides chains): PDB file : Tito_4F4V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4F4V-query.scw PDB file : Tito_Scwrl_4F4V.pdb: