Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR 3DAC Chain:P ((1-9)) ---------------------------------------------------------ETFSDLWKL--------

General information: TITO was launched using: RESULT: Template: 3DAC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 3 96 32.00 10.67 target 2D structure prediction score : 0.00 Monomeric hydrophicity matching model chain P : 0.56 3D Compatibility (PKB) : 32.00 2D Compatibility (Sec. Struct. Predict.) : 0.00 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.635

(partial model without unconserved sides chains): PDB file : Tito_3DAC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DAC-query.scw PDB file : Tito_Scwrl_3DAC.pdb: