Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMIKQCVICLSLLVFGTTAAHAEETPLVTARHMSKWEEIAVKEAKKRYPLAQVLFKQKVWDRKRKDEAVKQYHLTLREGSKEFGVFVTISFDPYSQKVNKIAILEEYQ 4K61 Chain:A ((28-76)) ---------------------------------------VQAALKKMYPTADGVAWSHD---------ESYYVADFLMNGFD----TKVWFDG-QAQWVMQQ------

General information: TITO was launched using: RESULT: Template: 4K61.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 161 -18045 -112.08 -368.26 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -112.08 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.563

(partial model without unconserved sides chains): PDB file : Tito_4K61.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K61-query.scw PDB file : Tito_Scwrl_4K61.pdb: