Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKIKDDCIELELTPRRYQELDDDPFILSVFELLENKKAVVRDFSAVLLESEYKVLISGIETMIKGNQDSISLETIEPFLFLSIDQENGNYRIKIKIIFDDYKESKSNSNLFEINCNEEKLESFVTALKLNLENTKNPSKLP 2YBF Chain:B ((8-19)) -------------------------------------------------KSEFQLLVDQAR---------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2YBF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1 -342 -342.00 -28.50 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -342.00 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.345

(partial model without unconserved sides chains): PDB file : Tito_2YBF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YBF-query.scw PDB file : Tito_Scwrl_2YBF.pdb: