Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----MVENSGIEPLTSCVQS-----RCSPS------
2Y8T Chain:B ((1-35))DIVQHMEDIGGAPPVSCVTNEILGVTCAPQAIAKAT


General information:
TITO was launched using:
RESULT:

Template: 2Y8T.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -1942 for 58 contacts (-33.5/contact) +
2D Compatibility (PS) -2390 + (NN) -2525 + (LL) 0
1D Compatibility (HY) -400 + (ID) 400
Total energy: -7657.0 ( -132.02 by residue)
QMean score : 0.762

(partial model without unconserved sides chains):
PDB file : Tito_2Y8T.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2Y8T-query.scw
PDB file : Tito_Scwrl_2Y8T.pdb: