Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MLGRTKLGNRNAQANNNAKKKNGFQTHFD-SYAGREAEKLIASNKRHND---------------------------------------------------------------------------------------- 2Y9W Chain:C ((9-150)) LDLPGTRILNGANWANNSAT--SGTLIIFDQSTPGQDADRWLIHNYLDGYKIFNMGSNNWASVSRGNTVLGVSEFDGQTCKWSIEYSGNGEEFWIRVPREGGGGAVWTIKPASSQGPTTVFLDLLKETDPNQRIKFAV

General information: TITO was launched using: RESULT: Template: 2Y9W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 101 8292 82.10 180.26 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain C : 0.57 3D Compatibility (PKB) : 82.10 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.181

(partial model without unconserved sides chains): PDB file : Tito_2Y9W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Y9W-query.scw PDB file : Tito_Scwrl_2Y9W.pdb: