Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------MTINLFFLT-LTIKKRFKSLEEFEREQQIEQIYDEMKESQ--LKHLYLTNWR 2MC5 Chain:A ((1-73)) MNEFTQISGYVNAFGSQRGSVLTVKVENDEGWTLVEEDFDRADYGSDPEFVAEVSSYLKRNGGIKDLTKVLTR

General information: TITO was launched using: RESULT: Template: 2MC5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 137 16071 117.31 327.98 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 117.31 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.371

(partial model without unconserved sides chains): PDB file : Tito_2MC5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MC5-query.scw PDB file : Tito_Scwrl_2MC5.pdb: