Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAVTCGDVTSAIAPCMSYATGKASAPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSFKGISMGNAATIPGKCGVSVSFPINTNVNCNNIH
1BWO Chain:A ((1-90))-IDCGHVDSLVRPCLSYVQGG-PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV-


General information:
TITO was launched using:
RESULT:

Template: 1BWO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -54730 for 622 contacts (-88.0/contact) +
2D Compatibility (PS) -9257 + (NN) -1044 + (LL) 332
1D Compatibility (HY) -10000 + (ID) 1850
Total energy: -76549.0 ( -123.07 by residue)
QMean score : 0.579

(partial model without unconserved sides chains):
PDB file : Tito_1BWO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BWO-query.scw
PDB file : Tito_Scwrl_1BWO.pdb: