Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSSKDNTCPPPGPGHINGFHVPHYAFFFPHMLGGMSXTGGLPGVQHQPPLSGYSTPSPATIETQSTSSEEIVPSPPTPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKESPKPEAIESYILSPETQDLIEKVQKAHQETFPALCQLGKYTTSFSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKSACLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQPVPLEMDDAETGLLSAICLICGDRQDLEQPDKVDKLQEPLLEALKIYVRTRRPQKPHMFPKMLMKITDLRTVSAKGAERVITLKMEIPGAM-PLIQEMLENSEGLDTLGGGASSDAPVTPVAPGSCSPSLSPSSTHSSPSTHSP
1EXA Chain:A ((5-240))-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLE--------------------------------------------


General information:
TITO was launched using:
RESULT:

Template: 1EXA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -135867 for 1846 contacts (-73.6/contact) +
2D Compatibility (PS) -24974 + (NN) -14501 + (LL) 5788
1D Compatibility (HY) -32000 + (ID) 9550
Total energy: -211104.0 ( -114.36 by residue)
QMean score : 0.496

(partial model without unconserved sides chains):
PDB file : Tito_1EXA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1EXA-query.scw
PDB file : Tito_Scwrl_1EXA.pdb: