Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDLHADTYIIDAVSV 3OTT Chain:A ((716-733)) ---------------------------------------------------------------------------------------------------NLSYGNYQLIISKLERDG---------------

General information: TITO was launched using: RESULT: Template: 3OTT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 -806 -806.00 -44.78 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -806.00 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.596

(partial model without unconserved sides chains): PDB file : Tito_3OTT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OTT-query.scw PDB file : Tito_Scwrl_3OTT.pdb: