Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK--- 2K8S Chain:A ((1-80)) VASKAIFYHAGCPVCVSAEQAVANAIDPS--KYTVEIVHLGTDKARIAEAEKAGVKSVPALVID---------GAAFHINFGAGIDDLKGS

General information: TITO was launched using: RESULT: Template: 2K8S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 326 -66959 -205.39 -869.59 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -205.39 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.292

(partial model without unconserved sides chains): PDB file : Tito_2K8S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K8S-query.scw PDB file : Tito_Scwrl_2K8S.pdb: