Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------MRNPVVWGMIYFAVGCIFTYLAASSPGSMWSFYSILLMVFAAYNISISFKMFAFSFKIKKNQK----------------------------------------------------------------------------------------------------------------------------------------- 5DSE Chain:B ((7-287)) GVVEEWLSEPNYATSLVSSLYKVIQEPLEPVCHQLFEFYRSGEEQLLQFTLQFLPELIWCYLAVSASG------CIEALLLGVYNLEIK----VLSFTIPSLSKPSVYHEPSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRICVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVANAIKASLP

General information: TITO was launched using: RESULT: Template: 5DSE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 53 -16009 -302.05 -302.05 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain B : 0.50 3D Compatibility (PKB) : -302.05 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.50 QMean score : -0.157

(partial model without unconserved sides chains): PDB file : Tito_5DSE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DSE-query.scw PDB file : Tito_Scwrl_5DSE.pdb: